Camelus ferus (Wild Bactrian camel): 102522050 Help Entry 102522050         CDS       T02979                                  Symbol IL5 Name (RefSeq) interleukin-5 isoform X2   KO K05428   interleukin 5 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04630   JAK-STAT signaling pathway cfr04640   Hematopoietic cell lineage cfr04657   IL-17 signaling pathway cfr04658   Th1 and Th2 cell differentiation cfr04660   T cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04672   Intestinal immune network for IgA production cfr05200   Pathways in cancer cfr05310   Asthma cfr05320   Autoimmune thyroid disease cfr05321   Inflammatory bowel disease cfr05330   Allograft rejection Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102522050 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102522050 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102522050 (IL5)    04660 T cell receptor signaling pathway     102522050 (IL5)    04658 Th1 and Th2 cell differentiation     102522050 (IL5)    04657 IL-17 signaling pathway     102522050 (IL5)    04664 Fc epsilon RI signaling pathway     102522050 (IL5)    04672 Intestinal immune network for IgA production     102522050 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102522050 (IL5)   09163 Immune disease    05310 Asthma     102522050 (IL5)    05320 Autoimmune thyroid disease     102522050 (IL5)    05321 Inflammatory bowel disease     102522050 (IL5)    05330 Allograft rejection     102522050 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102522050 (IL5)    00536 Glycosaminoglycan binding proteins [BR:cfr00536]     102522050 (IL5) Cytokines and neuropeptides [BR:cfr04052]  Cytokines   Interleukins    102522050 (IL5) Glycosaminoglycan binding proteins [BR:cfr00536]  Heparan sulfate / Heparin   Cytokines    102522050 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102522050 NCBI-ProteinID:  XP_006184146 UniProt:  A0A8B6YER9 LinkDB All DBs Position 3:complement(91873584..91876255) Genome browser AA seq 134 aa AA seqDB search MRLLLYLSLLGLGAAYVCVIAVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHTNH QLCIEEVFQGIDTLKNQTEQGDAVEKLFQNLSLIKEYIDLQKKKCGGERWQVKQFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagattgcttctgtatttgagtttgctaggtcttggagctgcctacgtttgtgtcatt gctgtagaaagtccgatgaatagactggtggcagagaccttgacactgctctccactcat cgaactctgctgataggcgatgggaacttgatgattcctactcctgaacatacaaatcac caactatgtattgaagaagtctttcagggaatagacacattgaagaatcaaactgaacaa ggggatgccgtggaaaagctattccaaaacttgtctttaattaaagaatatatagacctc caaaaaaaaaagtgtggaggagaaagatggcaagtaaaacagttcctagactacctgcaa gttttccttggcgtaataaacactgagtggacaacagaaagctga

DBGET integrated database retrieval system