Camelus ferus (Wild Bactrian camel): 102522438 Help Entry 102522438         CDS       T02979                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04010   MAPK signaling pathway cfr04014   Ras signaling pathway cfr04024   cAMP signaling pathway cfr04072   Phospholipase D signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04218   Cellular senescence cfr04371   Apelin signaling pathway cfr04625   C-type lectin receptor signaling pathway cfr04810   Regulation of actin cytoskeleton cfr05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102522438 (RRAS2)    04072 Phospholipase D signaling pathway     102522438 (RRAS2)    04024 cAMP signaling pathway     102522438 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102522438 (RRAS2)    04137 Mitophagy - animal     102522438 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102522438 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102522438 (RRAS2)    04031 GTP-binding proteins [BR:cfr04031]     102522438 (RRAS2) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102522438 (RRAS2)   Exosomal proteins of bladder cancer cells    102522438 (RRAS2) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102522438 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  102522438 NCBI-ProteinID:  XP_032344865 UniProt:  A0A8B8TSA8 LinkDB All DBs Position 10:48849856..48925854 Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaagagaagtaccggctcgtggtggtc ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta acggattatgatccaaccattgaggactcctacacaaagcagtgcgtgattgatgaccgg gcagcccggctagatattctggatacagcaggacaagaagagtttggagctatgagagaa cagtatatgagaactggagaaggtttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttt ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa gaaggacagcagttagcacgacagcttaaggtaacatacatggaggcgtcagcaaagatt aggatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctaa

DBGET integrated database retrieval system