Camelus ferus (Wild Bactrian camel): 102522450 Help Entry 102522450         CDS       T02979                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04080   Neuroactive ligand-receptor interaction cfr04081   Hormone signaling Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102522450 (PRLH)    04081 Hormone signaling     102522450 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfr04052]     102522450 (PRLH) Cytokines and neuropeptides [BR:cfr04052]  Neuropeptides   GPCR binding    102522450 (PRLH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  102522450 NCBI-ProteinID:  XP_006177865 UniProt:  S9YFF3 LinkDB All DBs Position 5:94710774..94713804 Genome browser AA seq 87 aa AA seqDB search MKALRAWLLCLLLLGLALRGAASRAHQHSMEIHTPDINPAWYTGRRIRPVGRFGRRRAAL RDVLKPGLRCLPACFPLEGGAEPAQGG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaggcgttgcgggcctggctcctgtgcctgctgctgctgggcctggccctgcggggg gcggccagccgcgcccaccagcactccatggagatccacacccctgacatcaacccggcc tggtacacgggccgcagaatccggcccgtgggccgcttcggccgcagaagagcagccctg agggatgtcctgaagcctggcctccggtgcctgccagcctgcttccccctggagggaggt gctgagcccgcccagggtggctga

DBGET integrated database retrieval system