Camelus ferus (Wild Bactrian camel): 102522472 Help Entry 102522472         CDS       T02979                                  Name (RefSeq) LOW QUALITY PROTEIN: cystatin-B   KO K13907   cystatin-A/B Organism cfr  Camelus ferus (Wild Bactrian camel) Brite KEGG Orthology (KO) [BR:cfr00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:cfr01002]     102522472   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102522472 Peptidases and inhibitors [BR:cfr01002]  Peptidase inhibitors   Family I25: cystatin family    102522472 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102522472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  102522472 NCBI-ProteinID:  XP_014411620 UniProt:  A0A8B7K7F6 LinkDB All DBs Position 2:complement(59332484..59332998) Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAEIQAIADQVKAQLEEKENKKFSLFKAVEFKSQVVAGRNFFIKVQVD DEEFVHLRVFESLPHENKPPALASYQTNKARHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggtgcgccctccgccacgcagccggccacggccgagatccaggccatcgcc gaccaggtgaaggcacagctggaggagaaggagaataagaagttctccctgtttaaggct gtggagttcaagagccaggtggtcgccggcaggaacttcttcatcaaggttcaggttgac gatgaggagttcgtgcaccttcgagtatttgagagcctcccacacgaaaacaagccccca gccttggccagctaccagaccaacaaagccaggcacgacgagctgtcctacttctag

DBGET integrated database retrieval system