Camelus ferus (Wild Bactrian camel): 102523003 Help Entry 102523003         CDS       T02979                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04066   HIF-1 signaling pathway cfr04120   Ubiquitin mediated proteolysis cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102523003 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102523003 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102523003 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     102523003 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102523003 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cfr04121]     102523003 (ELOC)    03400 DNA repair and recombination proteins [BR:cfr03400]     102523003 (ELOC) Ubiquitin system [BR:cfr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102523003 (ELOC)    Cul5 complex      102523003 (ELOC) DNA repair and recombination proteins [BR:cfr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102523003 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  102523003 NCBI-ProteinID:  XP_006185919 UniProt:  A0A8B6YGE6 LinkDB All DBs Position 29:11387978..11404144 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaaa ttgatatcttcggatggtcatgaatttattgtaaaaagagaacatgcgctaacatcagga acaataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcggtatactaacagctccacggaaattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcaaacttcctagattgttaa

DBGET integrated database retrieval system