Camelus ferus (Wild Bactrian camel): 106729279 Help Entry 106729279         CDS       T02979                                  Name (RefSeq) histone H2A type 1-B   KO K11251   histone H2A Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr03082   ATP-dependent chromatin remodeling cfr04217   Necroptosis cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106729279  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106729279  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106729279  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     106729279   09165 Substance dependence    05034 Alcoholism     106729279  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     106729279   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     106729279 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106729279 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106729279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  106729279 NCBI-ProteinID:  XP_032319302 UniProt:  S9X3T8 LinkDB All DBs Position 20:18054075..18055982 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaaacagggcggcaaagctcgcgccaaggccaagacccgctcttcg cgggccgggctccagttccccgtgggccgagtgcaccgcctgctccgcaaaggcaactac tccgagcgtgttggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc ccgcgccacctgcagctagccatccgcaacgatgaggagctcaacaagctactcggtcgc gtgactatcgctcagggcggcgtcctgcccaacattcaggcggtgctgctgcccaagaag actgagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system