Camelus ferus (Wild Bactrian camel): 116658356 Help Entry 116658356         CDS       T02979                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116658356  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     116658356   09163 Immune disease    05322 Systemic lupus erythematosus     116658356   09165 Substance dependence    05034 Alcoholism     116658356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     116658356 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116658356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  116658356 NCBI-ProteinID:  XP_032319318 UniProt:  S9W978 LinkDB All DBs Position 20:complement(18652291..18652712) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaaagggggaaagggccttggtaaaggaggcgctaagcgccatcgg aaggtgcttcgggacaacatccagggtatcaccaagcctgccattcggcgcctggcccgg cgaggtggtgtgaagcgcatctccggcctcatctacgaggagacccgcggcgtgctgaag gtgttcctggagaacgtgattcgggacgccgtcacctacaccgagcacgccaagcgcaag acggtcacagccatggacgtggtctacgcgctcaagcgccagggccgcactctctacggc ttcggcggctga

DBGET integrated database retrieval system