Camelus ferus (Wild Bactrian camel): 116661879 Help Entry 116661879         CDS       T02979                                  Name (RefSeq) histone H2B type F-M-like   KO K11252   histone H2B Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04613   Neutrophil extracellular trap formation cfr05034   Alcoholism cfr05203   Viral carcinogenesis cfr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116661879  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     116661879   09163 Immune disease    05322 Systemic lupus erythematosus     116661879   09165 Substance dependence    05034 Alcoholism     116661879  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfr03036]     116661879   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     116661879 Chromosome and associated proteins [BR:cfr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116661879 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116661879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF TFIID_20kDa TFIID-18kDa MCPsignal MRP-S27 DUF3408 Motif Other DBs NCBI-GeneID:  116661879 NCBI-ProteinID:  XP_032330588 UniProt:  A0A8B8SK34 LinkDB All DBs Position X:71736436..71736865 Genome browser AA seq 142 aa AA seqDB search MAEPRSAHTSEEIVDTGEPKEAECKSPEQKTPKQKTPVRRQRRRRRPADDFASFATYFRR VLKRVHTGLSLSQEAVSVMDSIVKDIFERIASEAARLARSKKRVTITYEDIQTSVCLLLP GKIGKFAVSKGTNALIKYILCE NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggctgagccgcggtccgcccacacttcggaggagatcgtggacaccggggagcccaaa gaagccgagtgcaagagcccagagcagaagacgccgaagcagaagacacccgtgcgccgc caacgccgccgccgccgcccagcagacgacttcgccagtttcgccacttacttccgcagg gtgctgaagcgggtgcacacaggcctgagcctctcgcaggaggccgtgagcgtcatggat tcgatcgttaaggacatcttcgagcgcatcgccagcgaggccgcgcgcctggcccgctcc aaaaagcgcgtcaccatcacctacgaagacatccagacctcggtgtgcctgctgctgcct gggaagatcggcaagtttgccgtgtccaagggcactaacgctctcatcaagtacatcttg tgcgaatga

DBGET integrated database retrieval system