Camelus ferus (Wild Bactrian camel): 116664962 Help Entry 116664962         CDS       T02979                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04382   Cornified envelope formation cfr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116664962  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116664962  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     116664962 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of microglial cells    116664962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  116664962 NCBI-ProteinID:  XP_032339856 UniProt:  S9Y688 LinkDB All DBs Position 7:complement(58248141..58261297) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHRFARDKGYLTKEDLKVLMAKEFPGFLENQKDTLALDKIMKDLD QCRDGRVGFQKFFSLIAGLTIACNDYFVVHIKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacatttcacagatttgct agggataaaggctatttaacaaaggaggacctgaaagtactcatggcaaaggagttccct ggatttttggaaaatcaaaaagacactctggccctggacaaaataatgaaggacctggac cagtgccgagacggcagagtgggcttccagaaattcttttcgctaatcgccgggctcacc attgcgtgcaatgactattttgtggtgcacataaagcagaagggaaagaagtag

DBGET integrated database retrieval system