Camelus ferus (Wild Bactrian camel): 116669020 Help Entry 116669020         CDS       T02979                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04010   MAPK signaling pathway cfr04020   Calcium signaling pathway cfr04022   cGMP-PKG signaling pathway cfr04114   Oocyte meiosis cfr04218   Cellular senescence cfr04310   Wnt signaling pathway cfr04360   Axon guidance cfr04370   VEGF signaling pathway cfr04380   Osteoclast differentiation cfr04625   C-type lectin receptor signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04658   Th1 and Th2 cell differentiation cfr04659   Th17 cell differentiation cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04720   Long-term potentiation cfr04724   Glutamatergic synapse cfr04921   Oxytocin signaling pathway cfr04922   Glucagon signaling pathway cfr04924   Renin secretion cfr05010   Alzheimer disease cfr05014   Amyotrophic lateral sclerosis cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05031   Amphetamine addiction cfr05152   Tuberculosis cfr05163   Human cytomegalovirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116669020 (PPP3R1)    04310 Wnt signaling pathway     116669020 (PPP3R1)    04370 VEGF signaling pathway     116669020 (PPP3R1)    04020 Calcium signaling pathway     116669020 (PPP3R1)    04022 cGMP-PKG signaling pathway     116669020 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116669020 (PPP3R1)    04218 Cellular senescence     116669020 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116669020 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     116669020 (PPP3R1)    04660 T cell receptor signaling pathway     116669020 (PPP3R1)    04658 Th1 and Th2 cell differentiation     116669020 (PPP3R1)    04659 Th17 cell differentiation     116669020 (PPP3R1)    04662 B cell receptor signaling pathway     116669020 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     116669020 (PPP3R1)    04921 Oxytocin signaling pathway     116669020 (PPP3R1)    04924 Renin secretion     116669020 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     116669020 (PPP3R1)    04720 Long-term potentiation     116669020 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     116669020 (PPP3R1)    04380 Osteoclast differentiation     116669020 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116669020 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116669020 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     116669020 (PPP3R1)    05163 Human cytomegalovirus infection     116669020 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     116669020 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     116669020 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     116669020 (PPP3R1)    05014 Amyotrophic lateral sclerosis     116669020 (PPP3R1)    05020 Prion disease     116669020 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     116669020 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     116669020 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116669020 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfr01009]     116669020 (PPP3R1) Protein phosphatases and associated proteins [BR:cfr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116669020 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  116669020 NCBI-ProteinID:  XP_032353596 UniProt:  A0A8B8UG89 LinkDB All DBs Position 15:complement(49523094..49576506) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcgagttatcctttggaaatgtgctcacactttgacgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctgggtctttgagtgtg gaagagttcatgtctctgcctgaattacaacaaaatcccctagtacagcgagtaatagat atattcgacacagacgggaatggagaagtagactttaaagagttcattgagggagtctct caattcagtgtcaaaggagataaagaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaacctgaaagacacacagttacagcagatcgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta gacatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system