Camelus ferus (Wild Bactrian camel): 5326221 Help Entry 5326221           CDS       T02979                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr00190   Oxidative phosphorylation cfr01100   Metabolic pathways cfr04714   Thermogenesis cfr04723   Retrograde endocannabinoid signaling cfr05010   Alzheimer disease cfr05012   Parkinson disease cfr05014   Amyotrophic lateral sclerosis cfr05016   Huntington disease cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05208   Chemical carcinogenesis - reactive oxygen species cfr05415   Diabetic cardiomyopathy Module cfr_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cfr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5326221 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     5326221 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     5326221 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     5326221 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     5326221 (ND6)    05012 Parkinson disease     5326221 (ND6)    05014 Amyotrophic lateral sclerosis     5326221 (ND6)    05016 Huntington disease     5326221 (ND6)    05020 Prion disease     5326221 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     5326221 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     5326221 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cfr03029]     5326221 (ND6) Enzymes [BR:cfr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      5326221 (ND6) Mitochondrial biogenesis [BR:cfr03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     5326221 (ND6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 Motif Other DBs NCBI-GeneID:  5326221 NCBI-ProteinID:  YP_001315083 UniProt:  A6YAS6 LinkDB All DBs Position MT:complement(13558..14085) Genome browser AA seq 175 aa AA seqDB search MMTYAVFILSIVFVIGFVSFSSKPSPIYGGLGLIVSGGVGCMIVLNFGGSFLGLMVFLIY LGGMMVVFGYTTAMATEQYPEVWVSNKTVLGAFIFGLVVEIAMVVCVLEGEEVDFIFKFN GLGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVVVTGWSLFIGVVVIMEVTRGN NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgatgacgtacgccgtatttattttaagtattgttttcgtgattggttttgttagtttt tcttctaagccttctcctatttatgggggattggggctaatcgttagtggtggggttggt tgtatgattgtgcttaactttggggggtctttcttgggtttgatggtgtttttgatttat ctggggggaataatggtagtttttgggtacactacggcaatagctacggaacagtacccg gaggtttgagtgtctaacaaaacggtgttgggggcttttatttttggcttagtggtggag atcgctatagttgtttgtgtgctggagggggaggaagtagattttatcttcaaatttaat ggactgggagattgagtaatttatgatactggggattctggattttttagtgaggaggca atgggaattgctgctttgtatagttatggtacttgactggtggttgttactgggtggtcc ctatttattggggtggtagttatcatagaagttacgcggggtaattaa

DBGET integrated database retrieval system