Collimonas fungivorans: CFU_1888 Help Entry CFU_1888          CDS       T01583                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cfu  Collimonas fungivorans Pathway cfu01100   Metabolic pathways cfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFU_1888    00074 Mycolic acid biosynthesis     CFU_1888   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFU_1888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEK61720 UniProt:  G0AK35 LinkDB All DBs Position 2229459..2229719 Genome browser AA seq 86 aa AA seqDB search MQQLEEEVKQVIIDVLQLEDMTPADIVSDAPLFVDGLGLDSIDALELGVAIQKRYGISLS ADSAETRNHFASVQTLAAMIASNRKK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcttgaagaagaagtgaagcaggtcatcatcgatgtcctgcagttggaagac atgactcccgccgacatcgtcagcgatgcgccgttgtttgtcgatggcctcggcctggat tcgatcgatgcgctggaactcggcgtggcgatccagaagcgttacggcatttcattgtcg gccgattcggccgagacgcgcaaccattttgcttcggtacagacgctggctgcaatgatc gccagcaacagaaagaaatga

DBGET integrated database retrieval system