Collimonas fungivorans: CFU_1889 Help Entry CFU_1889          CDS       T01583                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cfu  Collimonas fungivorans Pathway cfu01100   Metabolic pathways cfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFU_1889    00074 Mycolic acid biosynthesis     CFU_1889   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFU_1889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  AEK61721 UniProt:  G0AK36 LinkDB All DBs Position 2229729..2230001 Genome browser AA seq 90 aa AA seqDB search MTLTNSMSKEEIYLWLVNVLHEMFEIDKDQVTPQANLYTDLDIDSIDAVDLVVKLKQLTG KRLQPDVFKAVRTVQDVVDALAALLAEDEK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacattgaccaactcaatgagcaaggaagaaatctacctgtggctggtgaacgtgctg catgaaatgttcgagatcgacaaggaccaggtgacgccccaggccaacctgtataccgac ctcgatatcgacagcatcgatgcggtcgacctggtggtcaagctcaagcagctgaccggc aaacgcctgcagccggacgtgttcaaggcggtgcgcacggtgcaggacgtggtcgacgcg ctggcggccttgctggccgaggacgaaaagtaa

DBGET integrated database retrieval system