Collimonas fungivorans: CFU_1920 Help Entry CFU_1920          CDS       T01583                                  Symbol hfq Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism cfu  Collimonas fungivorans Pathway cfu02024   Quorum sensing cfu03018   RNA degradation Brite KEGG Orthology (KO) [BR:cfu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CFU_1920 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CFU_1920 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cfu03019]     CFU_1920 (hfq)    03036 Chromosome and associated proteins [BR:cfu03036]     CFU_1920 (hfq) Messenger RNA biogenesis [BR:cfu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CFU_1920 (hfq) Chromosome and associated proteins [BR:cfu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CFU_1920 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  AEK61752 UniProt:  G0AK67 LinkDB All DBs Position 2261829..2262065 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHTI STVVPARAVNLNLESEAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtaataaagggcaattgttacaagacccgtttttgaacgccttgcgtaaagagcat gttccggtgtctatctatctggtcaacggcatcaagcttcaaggccatatcgaatccttc gatcaatacgtcgttttactgcgtaataccgttacccaaatggtatacaaacacaccatc tcaaccgtagttcctgcacgcgctgtcaatctgaatcttgaatctgaagcagaataa

DBGET integrated database retrieval system