Choristoneura fumiferana (eastern spruce budworm): 141426444
Help
Entry
141426444 CDS
T11020
Symbol
Rpn8
Name
(RefSeq) regulatory particle non-ATPase 8
KO
K03038
26S proteasome regulatory subunit N8
Organism
cfum Choristoneura fumiferana (eastern spruce budworm)
Pathway
cfum03050
Proteasome
Brite
KEGG Orthology (KO) [BR:
cfum00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
141426444 (Rpn8)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
cfum03051
]
141426444 (Rpn8)
Proteasome [BR:
cfum03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
141426444 (Rpn8)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
JAB
MitMem_reg
FAM176
Motif
Other DBs
NCBI-GeneID:
141426444
NCBI-ProteinID:
XP_073941450
LinkDB
All DBs
Position
3:complement(7582121..7584604)
Genome browser
AA seq
325 aa
AA seq
DB search
MPSQEVVTTKVVVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRAKGVLDVSNSFAVP
FDEDDKDKSVWFLDHDYLENMYGMFKKVNAREKVVGWYHTGPKLHQNDVAINELIRRYCP
NSVLVIIDAKPKDLGLPTEAYRAVEEVHDDGSPTTRTFEHVPSEIGAEEAEEVGVEHLLR
DIKDTTVGSLSQRITNQLLGLRGLHSQLTEIRDYLLQVGQGSLPMNHQIIYQLQDIFNLL
PDIANDNFIDNLYIKTNDQSLVVYLAALVRSIIALHNLINNKITNRDAEEGKKEEAKKEK
KDKDDKDEKKTEDKAKGDKKDEKKK
NT seq
978 nt
NT seq
+upstream
nt +downstream
nt
atgcctagtcaagaagttgtgaccacaaaggtggtggttcaccccttagtgctgcttagc
gtcgtcgatcattttaatcgtatgggaaaaattggtaaccagaagcgggttgtcggtgtt
cttcttggctgctggcgagcaaagggtgttctggatgtctccaacagttttgcagttcca
tttgatgaggatgacaaagacaaatctgtatggtttcttgaccatgattacttagagaac
atgtatggcatgttcaaaaaggtcaatgcaagagaaaaagttgtgggctggtatcatact
ggacctaagttgcatcagaatgatgtagcaatcaatgagttgattaggcgttactgcccc
aactcagtcctggtcatcattgatgctaaaccgaaagacctaggtcttcctactgaagca
tatcgagcagtggaagaggtccatgatgatggcagtccgacaacacggacctttgaacat
gtccctagtgaaattggggctgaagaggctgaggaagttggtgtggagcatctgctgcga
gatatcaaggatacaacagttggaagcctctcacaaagaattaccaaccagctacttggc
ctaagaggtctccactcacagctgactgagatcagggattatttgcttcaagttggccag
ggttcattaccaatgaaccatcaaatcatttaccaactgcaggacatcttcaatctcctt
ccagacatagccaatgataactttattgataacctgtacatcaagaccaatgatcagtcc
cttgttgtgtaccttgctgcccttgtcagatcaataatcgcattacataacctaattaat
aataagataacaaaccgagatgcggaagaaggtaagaaggaagaagccaagaaagagaaa
aaagataaagatgacaaggatgaaaagaaaacagaagacaaagcgaaaggtgataagaag
gacgaaaagaaaaagtaa
DBGET
integrated database retrieval system