Cystobacter fuscus: CYFUS_002116 Help Entry CYFUS_002116      CDS       T05065                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism cfus  Cystobacter fuscus Brite KEGG Orthology (KO) [BR:cfus00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cfus03032]     CYFUS_002116    03036 Chromosome and associated proteins [BR:cfus03036]     CYFUS_002116    03400 DNA repair and recombination proteins [BR:cfus03400]     CYFUS_002116 DNA replication proteins [BR:cfus03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CYFUS_002116 Chromosome and associated proteins [BR:cfus03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CYFUS_002116 DNA repair and recombination proteins [BR:cfus03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CYFUS_002116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG MetW ARC6 Motif Other DBs NCBI-ProteinID:  ATB36701 UniProt:  A0A250IZW7 LinkDB All DBs Position complement(2573156..2573425) Genome browser AA seq 89 aa AA seqDB search MTKAELVEVVAAQSRLTKKSAAEILDIVFANIGKAVKKDQRFSYPGFGTWSVRSRKARKI RNPQTNEMMKLKASKTVGFRPAKELKNSL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccaaggcagagctcgtggaggtggtggcggcgcagtcgcggctgacgaagaagtcg gcggcggagattctcgacatcgtcttcgccaacatcggcaaggcggtgaagaaggaccag cgcttcagctacccgggcttcggcacgtggtcggttcgctctcgcaaggcgcggaagatc cgcaacccgcagaccaacgagatgatgaagctcaaggcatcgaagacggtgggcttccgg cccgccaaggaactgaagaactcgttgtag

DBGET integrated database retrieval system