KEGG   Cystobacter fuscus: CYFUS_002980
Entry
CYFUS_002980      CDS       T05065                                 
Name
(GenBank) YggS family pyridoxal phosphate enzyme
  KO
K06997  PLP dependent protein
Organism
cfus  Cystobacter fuscus
Brite
KEGG Orthology (KO) [BR:cfus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    CYFUS_002980
SSDB
Motif
Pfam: Ala_racemase_N SinI
Other DBs
NCBI-ProteinID: ATB37558
UniProt: A0A250J228
LinkDB
Position
complement(3658189..3658854)
AA seq 221 aa
MSGLAERLAEVRERMAAACARAGRPPESVTLVAVSKLKPAALIREAYAAGQRDFGENYAQ
ELRDKAAELADLKELRWHAIGPLQTNKVKYVAKAAHAYHALERLEVAEELSRRRLEAPLP
CHVEVNVGGEASKSGLAPEQVESFLKTVRALPGLRIDGLMSLPPPTDDEQVARGYFRALR
ELAQRHGLPGLSMGTTHDYELAIEEGATLVRVGTALFGERA
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagtggcctcgcggagcgcctggcggaggtgcgcgagcggatggcggcggcgtgtgcg
cgggcgggccggccgcccgagtccgtcaccctggtggccgtgtccaagctcaagccggcg
gcgctcatccgcgaggcgtacgcggcggggcagcgcgacttcggggagaactacgcccag
gagctgcgggacaaggccgcggagctggcagacctgaaggagctgcgctggcacgccatc
ggtcccctccagacgaacaaggtgaagtacgtggcgaaggcggcgcacgcctaccacgcg
ctggagcggctggaggtggccgaggagctgtcgcggcgccggctggaggcacccctgccc
tgccatgtggaggtgaacgtgggtggggaagccagcaagagtggcctcgcgcccgagcag
gtggagtccttcctgaagaccgtgcgtgccctgcccgggctgaggatcgacggcctcatg
tcactgccgccccccaccgacgacgagcaggtggcgcgcggctacttccgcgccctgcgg
gagctggcgcagcgccacgggctgccgggcctgtccatggggaccacgcatgactacgag
ctcgccatcgaggagggagccaccctggtccgggtaggcaccgccctcttcggcgagcgc
gcgtga

DBGET integrated database retrieval system