Cystobacter fuscus: CYFUS_007921 Help Entry CYFUS_007921      CDS       T05065                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism cfus  Cystobacter fuscus Pathway cfus01100   Metabolic pathways cfus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CYFUS_007921    00074 Mycolic acid biosynthesis     CYFUS_007921   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CYFUS_007921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATB42443 UniProt:  A0A250JFQ8 LinkDB All DBs Position complement(9916880..9917152) Genome browser AA seq 90 aa AA seqDB search MSRPEIRALIHRCLSEVEPQLKNLDLTEETALPELGLDSLKLIEVGVRLEDAFGDSVRFD NWLEQERTKQGNSAFKLASLISFIEERRAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagccgtccggaaatccgtgccctcatccaccgctgcctttccgaggtagagccccaa ctgaagaacctggacctcaccgaggagacggctctgcccgagctggggctcgactcgctc aagctcatcgaggtgggcgtccggctcgaggacgccttcggcgactccgtgcgcttcgac aactggctggagcaggagcgcaccaaacagggcaacagcgccttcaagctggcctcgctc atttccttcatcgaagagcggagggccgcgtga

DBGET integrated database retrieval system