Cyanobium gracile: Cyagr_2183 Help Entry Cyagr_2183        CDS       T02359                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cgc  Cyanobium gracile Pathway cgc01100   Metabolic pathways cgc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cgc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cyagr_2183    00074 Mycolic acid biosynthesis     Cyagr_2183   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cyagr_2183 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AFY29296 UniProt:  K9P9A5 LinkDB All DBs Position 2113932..2114174 Genome browser AA seq 80 aa AA seqDB search MSQEAIFAKVRSIVAEQLSVEADEVKPESNFQNDLGADSLDTVELVMALEEAFDIEIPDE SAEGITTVGDAVKYIQEKQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcccaggaagcgatcttcgcgaaagtccggtcgatcgttgccgaacagctcagcgtg gaggctgacgaggtcaagccggaatccaatttccagaacgacctgggagccgattccctc gacaccgtcgagctggtgatggccctggaggaagccttcgacatcgagatccccgacgag tcggccgaagggatcaccacggtgggtgacgccgtcaaatacatccaagagaagcaggcc tga

DBGET integrated database retrieval system