Cupriavidus gilardii: CR3_0175
Help
Entry
CR3_0175 CDS
T04050
Symbol
copB
Name
(GenBank) copper resistance protein CopB
KO
K07233
copper resistance protein B
Organism
cgd
Cupriavidus gilardii
Brite
KEGG Orthology (KO) [BR:
cgd00001
]
09190 Not Included in Pathway or Brite
09193 Unclassified: signaling and cellular processes
99994 Others
CR3_0175 (copB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CopB
Presenilin
TFIIA
Motif
Other DBs
NCBI-ProteinID:
ALD89434
LinkDB
All DBs
Position
1:223926..225125
Genome browser
AA seq
399 aa
AA seq
DB search
MPSKTLAAFLLASAGASAALAQQPHQHDHGDHHQHHHHHQHQHQQQHHQQHQHQHQHQHQ
HQHQQHQQQQQHGRDDHHGHHHQPAAAQPAAGKPAEAAAAHADKPGPDHGAMHHMDHGTA
QSMDHGAHGSGQGVPPASAPPPAMDHGDMKMQGGSAPPDARDPHAYSGGHRLGVGQYALG
PHRQLHMADEHLFGSVLVDRLEWARGSDTNAAAYEAQAWFGNTYDRLVIKAEGDVERGKV
HEARTELLWGHAIASYWDTQLGIRNDAGHGRPARNWLAFGVQGLAPYWFEIDATGYLGTE
GRTALRLSAEYELLITQRLILQPRIEANVYGKNDREVGVGSGLSNGAVGVRLRYEFSRQF
APYIGVERYQAFGNTADMVRASGGRSGETRFVAGVRVWF
NT seq
1200 nt
NT seq
+upstream
nt +downstream
nt
atgccttcgaaaacacttgcagccttcctgctggcgtccgccggcgccagcgccgcattg
gcacagcagccgcaccagcacgatcacggtgatcatcaccagcaccaccaccaccaccaa
caccagcaccagcagcagcatcatcagcagcaccagcaccagcaccagcaccagcaccag
caccagcaccagcagcatcagcagcagcagcagcacgggcgcgacgaccaccacgggcat
caccatcaaccggccgcggcacagcctgcggccggcaagcccgccgaagccgctgccgcg
cacgccgacaagccgggcccggaccatggcgcgatgcaccacatggaccacggcactgcg
caatcgatggaccacggcgcccatggctccgggcaaggcgtgccgcccgccagcgctccg
ccaccggcgatggatcacggcgacatgaagatgcagggcggcagcgctccccccgatgcg
cgcgatccgcacgcatactccggcggtcatcggctcggcgtcggccagtacgcgctcggt
ccccatcgccagctgcacatggccgacgagcatctgttcggctcggtgctggtggaccgc
ctcgaatgggcgcgcggcagcgacaccaacgccgccgcgtacgaggcacaggcctggttc
ggcaatacctacgaccggctggtgatcaaggccgagggcgacgtggaacgcggcaaggtc
catgaggcccgcaccgaactgctgtggggccacgcgatcgccagctattgggacacccag
ctcggtatccgcaacgacgcgggtcacggccgccccgcgcgcaactggctcgcgttcggc
gtgcagggcctggcgccctactggttcgagatcgacgccaccggctacctcggcaccgaa
gggcggacggcgctgcggctgtccgccgagtacgagttgctgatcacgcagcgcctgatc
ctgcagccgcgcatcgaggccaatgtctacggcaagaacgaccgcgaggttggcgtcggc
agcggcctgtccaatggcgcggtcggcgtgcggctacgctatgagttcagccgccagttc
gcgccctacatcggcgtcgagcgctatcaggcgttcggcaataccgccgacatggtgcgc
gcgtcgggcggccgcagcggtgagacgcgttttgtcgccggcgtgcgcgtgtggttctga
DBGET
integrated database retrieval system