Cricetulus griseus (Chinese hamster): 100689311 Help Entry 100689311         CDS       T02813                                  Symbol Gstp1 Name (RefSeq) glutathione S-transferase P 1   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge00480   Glutathione metabolism cge00980   Metabolism of xenobiotics by cytochrome P450 cge00982   Drug metabolism - cytochrome P450 cge00983   Drug metabolism - other enzymes cge01100   Metabolic pathways cge01524   Platinum drug resistance cge05200   Pathways in cancer cge05204   Chemical carcinogenesis - DNA adducts cge05215   Prostate cancer cge05225   Hepatocellular carcinoma cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100689311 (Gstp1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100689311 (Gstp1)    00982 Drug metabolism - cytochrome P450     100689311 (Gstp1)    00983 Drug metabolism - other enzymes     100689311 (Gstp1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100689311 (Gstp1)    05204 Chemical carcinogenesis - DNA adducts     100689311 (Gstp1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100689311 (Gstp1)    05215 Prostate cancer     100689311 (Gstp1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100689311 (Gstp1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100689311 (Gstp1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cge02000]     100689311 (Gstp1) Enzymes [BR:cge01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100689311 (Gstp1) Transporters [BR:cge02000]  Other transporters   Pores ion channels [TC:1]    100689311 (Gstp1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 GST_N_3 GST_C_2 Motif Other DBs NCBI-GeneID:  100689311 NCBI-ProteinID:  NP_001233673 UniProt:  P46424 A0A8C2MT86 LinkDB All DBs Position 3:55201459..55203668 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRILLADQGQSWKEEVVTVETWRKGSLKSTCLYGQLPKFEDGD LTLYQSNAILRHLGRSLGLYGKDQREAALVDMVNDGVEDLRCKYITLIYTKYEEGKDDYV KALPGHLKPFETLLSQNQGGKAFIVGDQISFVDYNLLDLLLIHQVLAPGCLDNFPLLSAY VARLSARPKIKAFLSSPDHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccatacaccattgtctacttcccagttcgaggacgctgtgaggccatgcgcata ctgctggctgaccagggccagagctggaaggaggaggtggttactgtagaaacctggagg aaaggttcgctcaagtccacctgtttgtatgggcagctccctaaatttgaggatggagac ctcaccctgtaccaatctaatgccatcttgaggcacctgggccgatccttggggctttat gggaaagaccagagggaggctgccctggtggatatggtgaatgatggggtggaagacctt cgctgcaaatacatcaccctcatctacaccaaatatgaggagggcaaggatgactatgtg aaggccctgcctggacacctgaagccctttgagaccctgctgtcccagaaccaagggggc aaagccttcatcgtgggtgaccagatctcctttgtggattacaacttgctagatctgctg ctgatccaccaggtcctggcccctggctgcctggacaacttccccctgctctctgcctat gtggcacggcttagtgcccggcccaagatcaaggccttcctgtcctcccctgaccatgtg aaccgtcccattaatggcaatggcaagcagtaa

DBGET integrated database retrieval system