Cricetulus griseus (Chinese hamster): 100689479 Help Entry 100689479         CDS       T02813                                  Symbol Mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100689479 (Mt2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cge03019]     100689479 (Mt2)    03029 Mitochondrial biogenesis [BR:cge03029]     100689479 (Mt2) Messenger RNA biogenesis [BR:cge03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100689479 (Mt2) Mitochondrial biogenesis [BR:cge03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100689479 (Mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100689479 NCBI-ProteinID:  NP_001231506 UniProt:  P67981 LinkDB All DBs Position 3:170372882..170373439 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATDGSCSCAGSCKCKECKCTTCKKSCCSCCPVGCAKCSQGCVCKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgtgctacagatggatcctgctcctgcgctgggtcttgcaaa tgcaaagagtgcaaatgcaccacctgcaagaaaagctgctgctcctgctgcccggtgggc tgtgcgaagtgctcccagggctgcgtctgcaaagaggcttcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system