Cricetulus griseus (Chinese hamster): 100752003 Help Entry 100752003         CDS       T02813                                  Name (RefSeq) histone H2B subacrosomal variant   KO K11252   histone H2B Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05203   Viral carcinogenesis cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100752003  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100752003   09163 Immune disease    05322 Systemic lupus erythematosus     100752003   09165 Substance dependence    05034 Alcoholism     100752003  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100752003   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100752003 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100752003 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100752003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_ABTB TFIID_20kDa TAF PBC CaiF_GrlA PaaX_M Motif Other DBs NCBI-GeneID:  100752003 NCBI-ProteinID:  XP_027257029 UniProt:  G3IP44 LinkDB All DBs Position 2:complement(317760386..317760751) Genome browser AA seq 121 aa AA seqDB search MAKSIIKRYQFVKRRQRRAFRKRYSSINFGQRNYSLYISRVLKEVVPMRGLSSNTVDIMN TLINDLFERIATEACQLMYFRKRCTLTLEDIQKAVYLLVPKKLAKSAVTFGSKAVHRFIH S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggccaagtccatcatcaaaaggtaccaatttgtcaaaagacgtcaaagacgagccttc agaaaacgttattccagcatcaattttggccaaagaaattactctctctacataagcagg gtcctgaaggaagttgtccccatgagaggcctgtcatcgaacactgtggacattatgaac accctgatcaatgacctctttgaacgcattgccacggaagcctgccaactgatgtacttc agaaagcgctgcaccctcaccctagaagatatccagaaggcagtgtatctgctggtgcct aagaagctggctaagtcggcagtgacttttggaagtaaagcagtgcacagatttatccac tcctaa

DBGET integrated database retrieval system