Cricetulus griseus (Chinese hamster): 100753137 Help Entry 100753137         CDS       T02813                                  Name (RefSeq) histone H3.3A isoform X2   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100753137  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100753137   09163 Immune disease    05322 Systemic lupus erythematosus     100753137   09165 Substance dependence    05034 Alcoholism     100753137  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100753137   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100753137 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100753137 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100753137 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100753137 NCBI-ProteinID:  XP_027274635 UniProt:  A0A3L7HJ39 LinkDB All DBs Position 5:13475902..13486337 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaaaaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaaatccactgaa cttctgattcgcaagctccccttccagcgtctggttcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaacctgtgtgctatccacgccaaacgtgtaacaatt atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system