Cricetulus griseus (Chinese hamster): 100753478 Help Entry 100753478         CDS       T02813                                  Symbol Pfn1 Name (RefSeq) profilin-1 isoform X2   KO K05759   profilin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04015   Rap1 signaling pathway cge04810   Regulation of actin cytoskeleton cge05014   Amyotrophic lateral sclerosis cge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100753478 (Pfn1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100753478 (Pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100753478 (Pfn1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100753478 (Pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cge04131]     100753478 (Pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cge04812]     100753478 (Pfn1)    04147 Exosome [BR:cge04147]     100753478 (Pfn1) Membrane trafficking [BR:cge04131]  Others   Actin-binding proteins    Others     100753478 (Pfn1) Cytoskeleton proteins [BR:cge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100753478 (Pfn1) Exosome [BR:cge04147]  Exosomal proteins   Proteins found in most exosomes    100753478 (Pfn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100753478 NCBI-ProteinID:  XP_027282708 UniProt:  A0A3L7GNI5 LinkDB All DBs Position 7:complement(84464120..84466909) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacagcctcatggcggacgggacctgtcaggacgcg gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc gtgaatgggctgacactcgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat gttactgtcaccatgactgccaaaacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system