Cricetulus griseus (Chinese hamster): 100753731 Help Entry 100753731         CDS       T02813                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100753731  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100753731   09163 Immune disease    05322 Systemic lupus erythematosus     100753731   09165 Substance dependence    05034 Alcoholism     100753731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100753731   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100753731 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100753731 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100753731 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  100753731 NCBI-ProteinID:  XP_027281098 UniProt:  A0A3L7H9U7 LinkDB All DBs Position 7:complement(131009152..131009523) Genome browser AA seq 115 aa AA seqDB search MARPKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVTLREIRRYQKYTE LIRKLPFQHLVREIAQDFKTDLRFQSAAIGALQEASEAYLVSLFEDTNMCTTPNV NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggctcgtccaaagcagactgcccgaaaatccaccggtggtaaagcacccaggaaacaa ttggctacaaaagccgctcgcaaaagtgcgccctctactggaggggtgaaaaaacctcat cgttacaggcctggtactgtgacactccgtgaaatcagacgctatcagaaatacactgaa ctgattcgcaagctccccttccagcatctggttagagaaattgctcaggacttcaaaaca gatttgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctatctg gttagcctttttgaagataccaacatgtgtaccacgccaaacgtgtaa

DBGET integrated database retrieval system