Cricetulus griseus (Chinese hamster): 100754314 Help Entry 100754314         CDS       T02813                                  Symbol Ppp3r2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04010   MAPK signaling pathway cge04020   Calcium signaling pathway cge04022   cGMP-PKG signaling pathway cge04114   Oocyte meiosis cge04218   Cellular senescence cge04310   Wnt signaling pathway cge04360   Axon guidance cge04370   VEGF signaling pathway cge04380   Osteoclast differentiation cge04625   C-type lectin receptor signaling pathway cge04650   Natural killer cell mediated cytotoxicity cge04658   Th1 and Th2 cell differentiation cge04659   Th17 cell differentiation cge04660   T cell receptor signaling pathway cge04662   B cell receptor signaling pathway cge04720   Long-term potentiation cge04724   Glutamatergic synapse cge04921   Oxytocin signaling pathway cge04922   Glucagon signaling pathway cge04924   Renin secretion cge05010   Alzheimer disease cge05014   Amyotrophic lateral sclerosis cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05031   Amphetamine addiction cge05152   Tuberculosis cge05163   Human cytomegalovirus infection cge05166   Human T-cell leukemia virus 1 infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05170   Human immunodeficiency virus 1 infection cge05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100754314 (Ppp3r2)    04310 Wnt signaling pathway     100754314 (Ppp3r2)    04370 VEGF signaling pathway     100754314 (Ppp3r2)    04020 Calcium signaling pathway     100754314 (Ppp3r2)    04022 cGMP-PKG signaling pathway     100754314 (Ppp3r2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100754314 (Ppp3r2)    04218 Cellular senescence     100754314 (Ppp3r2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100754314 (Ppp3r2)    04650 Natural killer cell mediated cytotoxicity     100754314 (Ppp3r2)    04660 T cell receptor signaling pathway     100754314 (Ppp3r2)    04658 Th1 and Th2 cell differentiation     100754314 (Ppp3r2)    04659 Th17 cell differentiation     100754314 (Ppp3r2)    04662 B cell receptor signaling pathway     100754314 (Ppp3r2)   09152 Endocrine system    04922 Glucagon signaling pathway     100754314 (Ppp3r2)    04921 Oxytocin signaling pathway     100754314 (Ppp3r2)    04924 Renin secretion     100754314 (Ppp3r2)   09156 Nervous system    04724 Glutamatergic synapse     100754314 (Ppp3r2)    04720 Long-term potentiation     100754314 (Ppp3r2)   09158 Development and regeneration    04360 Axon guidance     100754314 (Ppp3r2)    04380 Osteoclast differentiation     100754314 (Ppp3r2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100754314 (Ppp3r2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100754314 (Ppp3r2)    05170 Human immunodeficiency virus 1 infection     100754314 (Ppp3r2)    05163 Human cytomegalovirus infection     100754314 (Ppp3r2)    05167 Kaposi sarcoma-associated herpesvirus infection     100754314 (Ppp3r2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100754314 (Ppp3r2)   09164 Neurodegenerative disease    05010 Alzheimer disease     100754314 (Ppp3r2)    05014 Amyotrophic lateral sclerosis     100754314 (Ppp3r2)    05020 Prion disease     100754314 (Ppp3r2)    05022 Pathways of neurodegeneration - multiple diseases     100754314 (Ppp3r2)   09165 Substance dependence    05031 Amphetamine addiction     100754314 (Ppp3r2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100754314 (Ppp3r2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cge01009]     100754314 (Ppp3r2) Protein phosphatases and associated proteins [BR:cge01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100754314 (Ppp3r2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 Motif Other DBs NCBI-GeneID:  100754314 NCBI-ProteinID:  XP_027258896 UniProt:  A0A9J7JHW7 LinkDB All DBs Position 2:93817597..93818109 Genome browser AA seq 170 aa AA seqDB search MGNETSYQSAMCNHFDQDEIRRLGRSFRKMDLDKSGSLSIDEFMSLPELQQNPLVSRVID IFDTDGNGEVDFHEFIMGTSQFSVKGDEEQKLRFAFRVYDMDKDGYISNGELFHVLKMMV GNNLMDWQLQQLVDKTILVLDKDGDGRISFTEFCDVVKNMEIHKKLVVFV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgagaccagctaccaatccgcgatgtgcaaccactttgaccaggatgagatt agaaggttgggcagaagtttcaggaagatggacttggacaaatcgggctccctgagcata gatgagtttatgtcgctgcctgagctgcagcagaacccactggtaagtcgagtgatcgac atcttcgacacggatggcaatggggaagtggacttccatgagttcatcatgggcacctcg cagttcagcgtcaagggcgacgaagaacagaagttaagattcgccttcagagtctacgac atggacaaagatggctacatctccaatggggagctcttccacgtgctgaagatgatggtg ggtaacaacctcatggactggcagctgcagcagctggtggacaaaactatcttggtcctg gataaggacggcgatggccggatatccttcacagagttctgtgatgtggtgaaaaacatg gagatccacaagaagttggtcgtgtttgtgtga

DBGET integrated database retrieval system