Cricetulus griseus (Chinese hamster): 100754763 Help Entry 100754763         CDS       T02813                                  Name (RefSeq) histone H2A-Bbd type 1   KO K11251   histone H2A Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03082   ATP-dependent chromatin remodeling cge04217   Necroptosis cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100754763  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100754763  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100754763  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100754763   09165 Substance dependence    05034 Alcoholism     100754763  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100754763   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100754763 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100754763 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100754763 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Motif Other DBs NCBI-GeneID:  100754763 NCBI-ProteinID:  XP_027288493 UniProt:  G3IKM5 LinkDB All DBs Position X:88330622..88330942 Genome browser AA seq 106 aa AA seqDB search MSGKRQRRSRSRRAKLQFPVSRVNRFLRERNYCQRLSSCAPVFLARIVEYLLSNILVLAA KEAYFNGQKCITQEHLYQAIQSDEELYQLFTEDTNSVVALLEAKGN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaaaaaggcaaagacgatcccgttccagaagagccaaacttcaatttcccgtt agccgtgtgaaccgtttccttcgagaaagaaactattgccagcgcctgagctcttgtgct cctgtgttcctcgctcgtatagtagagtacttgttatccaacatccttgtgctggctgct aaggaagcctactttaatggccagaagtgcatcacccaagagcacttatatcaggcaata cagagcgacgaagagctctatcaactcttcacagaagacaccaactctgtggttgctttg ctagaagcaaaggggaactaa

DBGET integrated database retrieval system