Cricetulus griseus (Chinese hamster): 100755060 Help Entry 100755060         CDS       T02813                                  Symbol Il5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04630   JAK-STAT signaling pathway cge04640   Hematopoietic cell lineage cge04657   IL-17 signaling pathway cge04658   Th1 and Th2 cell differentiation cge04660   T cell receptor signaling pathway cge04664   Fc epsilon RI signaling pathway cge04672   Intestinal immune network for IgA production cge05200   Pathways in cancer cge05310   Asthma cge05320   Autoimmune thyroid disease cge05321   Inflammatory bowel disease cge05330   Allograft rejection Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100755060 (Il5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100755060 (Il5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100755060 (Il5)    04660 T cell receptor signaling pathway     100755060 (Il5)    04658 Th1 and Th2 cell differentiation     100755060 (Il5)    04657 IL-17 signaling pathway     100755060 (Il5)    04664 Fc epsilon RI signaling pathway     100755060 (Il5)    04672 Intestinal immune network for IgA production     100755060 (Il5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100755060 (Il5)   09163 Immune disease    05310 Asthma     100755060 (Il5)    05320 Autoimmune thyroid disease     100755060 (Il5)    05321 Inflammatory bowel disease     100755060 (Il5)    05330 Allograft rejection     100755060 (Il5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100755060 (Il5)    00536 Glycosaminoglycan binding proteins [BR:cge00536]     100755060 (Il5) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interleukins    100755060 (Il5) Glycosaminoglycan binding proteins [BR:cge00536]  Heparan sulfate / Heparin   Cytokines    100755060 (Il5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  100755060 NCBI-ProteinID:  XP_027282015 UniProt:  A0A8C2N2M5 LinkDB All DBs Position 7:67870555..67873391 Genome browser AA seq 132 aa AA seqDB search MRLFLHLSVLTVACVWAMAMEIPMSMVVKETLIQLSTHRALLTSNETVRLPVPTHKNHQL CIREIFQGLDILKNQTVRGGSVETLFQNLSLIKKYIDRQKEQCGQERRKARQFLDYLQEF LGVMGTEWTMEG NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgagactgtttctgcacttgagtgttttaactgttgcctgtgtctgggccatggctatg gagatccccatgagcatggtggtgaaagagaccttgatacagctatccactcaccgagct ctactgacaagcaacgagacggtgaggcttcctgttcctactcataaaaatcaccagctg tgcatcagagaaatctttcaggggctagacatactgaagaatcaaaccgtccgtgggggt tccgtggaaacactattccaaaacttgtcattaataaagaaatacattgaccgccaaaaa gagcagtgcggccaggagaggcggaaagcgaggcagttcctggattacctgcaagagttc cttggtgtgatgggtacagagtggacaatggaaggctaa

DBGET integrated database retrieval system