KEGG   Cricetulus griseus (Chinese hamster): 100756792
Entry
100756792         CDS       T02813                                 
Symbol
Rac1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04071  Sphingolipid signaling pathway
cge04145  Phagosome
cge04148  Efferocytosis
cge04151  PI3K-Akt signaling pathway
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04517  IgSF CAM signaling
cge04518  Integrin signaling
cge04519  Cadherin signaling
cge04520  Adherens junction
cge04530  Tight junction
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04810  Regulation of actin cytoskeleton
cge04932  Non-alcoholic fatty liver disease
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04972  Pancreatic secretion
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05100  Bacterial invasion of epithelial cells
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05163  Human cytomegalovirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05208  Chemical carcinogenesis - reactive oxygen species
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05231  Choline metabolism in cancer
cge05415  Diabetic cardiomyopathy
cge05416  Viral myocarditis
cge05417  Lipid and atherosclerosis
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100756792 (Rac1)
   04014 Ras signaling pathway
    100756792 (Rac1)
   04015 Rap1 signaling pathway
    100756792 (Rac1)
   04310 Wnt signaling pathway
    100756792 (Rac1)
   04370 VEGF signaling pathway
    100756792 (Rac1)
   04071 Sphingolipid signaling pathway
    100756792 (Rac1)
   04024 cAMP signaling pathway
    100756792 (Rac1)
   04151 PI3K-Akt signaling pathway
    100756792 (Rac1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100756792 (Rac1)
   04518 Integrin signaling
    100756792 (Rac1)
   04519 Cadherin signaling
    100756792 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100756792 (Rac1)
   04148 Efferocytosis
    100756792 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100756792 (Rac1)
   04520 Adherens junction
    100756792 (Rac1)
   04530 Tight junction
    100756792 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100756792 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100756792 (Rac1)
   04620 Toll-like receptor signaling pathway
    100756792 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    100756792 (Rac1)
   04662 B cell receptor signaling pathway
    100756792 (Rac1)
   04664 Fc epsilon RI signaling pathway
    100756792 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    100756792 (Rac1)
   04670 Leukocyte transendothelial migration
    100756792 (Rac1)
   04062 Chemokine signaling pathway
    100756792 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    100756792 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100756792 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    100756792 (Rac1)
   04380 Osteoclast differentiation
    100756792 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100756792 (Rac1)
   05205 Proteoglycans in cancer
    100756792 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100756792 (Rac1)
   05203 Viral carcinogenesis
    100756792 (Rac1)
   05231 Choline metabolism in cancer
    100756792 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100756792 (Rac1)
   05212 Pancreatic cancer
    100756792 (Rac1)
   05211 Renal cell carcinoma
    100756792 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100756792 (Rac1)
   05163 Human cytomegalovirus infection
    100756792 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100756792 (Rac1)
   05169 Epstein-Barr virus infection
    100756792 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100756792 (Rac1)
   05135 Yersinia infection
    100756792 (Rac1)
   05100 Bacterial invasion of epithelial cells
    100756792 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100756792 (Rac1)
   05020 Prion disease
    100756792 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    100756792 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100756792 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    100756792 (Rac1)
   05415 Diabetic cardiomyopathy
    100756792 (Rac1)
   05416 Viral myocarditis
    100756792 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100756792 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100756792 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100756792 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100756792 (Rac1)
   04031 GTP-binding proteins [BR:cge04031]
    100756792 (Rac1)
Membrane trafficking [BR:cge04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100756792 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100756792 (Rac1)
  Macropinocytosis
   Ras GTPases
    100756792 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100756792 (Rac1)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100756792 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   100756792 (Rac1)
  Exosomal proteins of colorectal cancer cells
   100756792 (Rac1)
  Exosomal proteins of bladder cancer cells
   100756792 (Rac1)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100756792 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 100756792
NCBI-ProteinID: XP_027269380
UniProt: A0A061I5F7
LinkDB
Position
4:complement(80007598..80030963)
AA seq 197 aa
MNFGSFCYHLSRAMTPGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGL
WDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGT
KLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRA
VLCPPPVKKRKRKCLLL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaacttcggatccttctgctaccacttgtccagagctatgactccaggagctgttggt
aaaacctgcctgctgatcagttacacaaccaatgcatttcctggagaatacatccccacc
gtctttgacaactattctgccaatgttatggtagatggaaagccagtgaatctgggctta
tgggatacagctggacaagaagattatgacagattgcgtcccctctcctatccgcaaaca
gacgtgttcttaatttgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgca
aagtggtatcctgaagtgcgacaccactgtcccaacactcccatcatcctggtgggaacg
aagcttgatctcagggatgataaggatacaattgagaagctgaaggagaagaagctgact
cctatcacctacccgcaggggctagccatggcaaaagagatcggcgctgtcaaatacctg
gagtgctcagcgctcacacagcgaggcctcaagacagtgtttgatgaagctatccgagcg
gttctctgtccacctcctgttaagaagaggaagagaaaatgcctgttgttgtaa

DBGET integrated database retrieval system