KEGG   Cricetulus griseus (Chinese hamster): 100757452
Entry
100757452         CDS       T02813                                 
Symbol
Itgax
Name
(RefSeq) integrin alpha-X isoform X2
  KO
K06462  integrin alpha X
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04610  Complement and coagulation cascades
cge04810  Regulation of actin cytoskeleton
cge05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100757452 (Itgax)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100757452 (Itgax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100757452 (Itgax)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cge04515]
    100757452 (Itgax)
   04090 CD molecules [BR:cge04090]
    100757452 (Itgax)
Cell adhesion molecules [BR:cge04515]
 Integrins
  Integrin alpha subunits
   100757452 (Itgax)
CD molecules [BR:cge04090]
 Proteins
  100757452 (Itgax)
SSDB
Motif
Pfam: VWA VWA_2 FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 100757452
NCBI-ProteinID: XP_027260289
LinkDB
Position
3:complement(72650633..72674272)
AA seq 257 aa
MNCTWKALLLLTAFVSSLGFNLDTEKPTHFHMDVSGFGYSVAQYDDTWVVVGAPKEIRAT
NQMGGLYRCAYDVEKCEPVHFQVPPEAVNMSLGLSLTAASNPSRLLACGPTVHHTCRENI
YLTGLCFLLGSSNPPYQRFPTAPQECPRQDQDIVFLIDGSGSISSRDFQTMLKFVETVMR
QFHRPRTQFSLMQFSHQFLTHFTFNDFVSAVNPLSRLNSVRQLGGFTYTATAIKRAITIH
CPKWGSERCHQSPHCHY
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaactgtacttggaaagcccttcttctgctgacagcatttgtttcttctcttggcttc
aacttggacacagagaagccgacacatttccatatggatgtttctgggttcggatacagt
gtggcccagtatgacgacacctgggtggtggttggagctccaaaggaaataagagccact
aaccaaatgggtggcctctatcgatgtgcctatgatgtagaaaagtgtgagcctgtccac
ttccaggtgcccccagaagctgtgaacatgtccctgggcctgtccctcactgctgccagc
aacccttcgaggctattggcctgtggtcctactgtgcaccatacatgcagagagaatata
tacttgacaggactctgctttctactgggctcatcaaatccgccgtaccaaaggttcccc
actgccccacaggagtgtccaaggcaggaccaagacattgtgttcttgattgatggctcg
gggagcatctcttcaagagattttcaaacaatgctgaaattcgtggagactgtgatgaga
caattccatcgaccccgcacacagttctccctgatgcagttctcccatcaattcctgaca
cattttactttcaatgacttcgtctccgctgtaaaccctttaagccggttgaactctgta
aggcagctgggagggttcacatacacggccacagctatcaagcgtgccataactattcac
tgcccaaagtggggctcggaaagatgccaccagagtcctcattgtcattactga

DBGET integrated database retrieval system