Cricetulus griseus (Chinese hamster): 100758292 Help Entry 100758292         CDS       T02813                                  Symbol Txn Name (RefSeq) thioredoxin isoform X2   KO K03671   thioredoxin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04621   NOD-like receptor signaling pathway cge05012   Parkinson disease cge05132   Salmonella infection cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100758292 (Txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100758292 (Txn)   09164 Neurodegenerative disease    05012 Parkinson disease     100758292 (Txn)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100758292 (Txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cge03110]     100758292 (Txn) Chaperones and folding catalysts [BR:cge03110]  Protein folding catalysts   Protein disulfide isomerase    100758292 (Txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 AhpC-TSA Thioredoxin_7 OST3_OST6 Thioredoxin_9 Glutaredoxin NODP Motif Other DBs NCBI-GeneID:  100758292 NCBI-ProteinID:  XP_027258840 UniProt:  A0A8C2LND3 LinkDB All DBs Position 2:85909757..85921036 Genome browser AA seq 105 aa AA seqDB search MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCEKYSSVVFLEVDVD DCQDVAAECEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEFA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggcggctgcgggagac aaacttgtagttgtggacttctcagccacatggtgtggaccatgcaaaatgatcaagccc ttctttcattccctctgtgaaaaatattccagtgtcgtgttccttgaagtagatgtggat gactgccaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagttttat aaaaagggtcaaaaggtgggtgaattctcaggcgctaacaaggaaaagcttgaagcctct attactgagtttgcctaa

DBGET integrated database retrieval system