Cricetulus griseus (Chinese hamster): 100758808 Help Entry 100758808         CDS       T02813                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04066   HIF-1 signaling pathway cge04120   Ubiquitin mediated proteolysis cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100758808  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100758808  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100758808   09162 Cancer: specific types    05211 Renal cell carcinoma     100758808   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100758808  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cge04121]     100758808    03400 DNA repair and recombination proteins [BR:cge03400]     100758808 Ubiquitin system [BR:cge04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100758808    Cul5 complex      100758808 DNA repair and recombination proteins [BR:cge03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100758808 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin NS1_C Motif Other DBs NCBI-GeneID:  100758808 NCBI-ProteinID:  XP_027253928 UniProt:  A0A9J7JD52 LinkDB All DBs Position 2:9401975..9402331 Genome browser AA seq 118 aa AA seqDB search MAVFLMIRRHKTTIFTDAKESSTVSELKPIVQGFLKQEPYKQHLYKDDNLLFDSKTLGKS GFTSQTAGPQAPATVGLAFLAGDAFEDLRIEPFSSPPDPSHVMKPQDSGGSAHEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccgtgtttctcatgatccggcgccacaagaccaccatcttcacggatgccaaggag tcgagtaccgtgtcggagctgaagcccatcgtccaaggcttcctcaagcaggagccgtac aagcagcatctgtacaaggatgacaacctcctttttgacagcaaaactctgggaaagagt ggcttcactagccaaacagcagggccccaggccccagccacagtgggcctggccttccta gcaggtgatgcctttgaagacctgcgcattgagcccttctccagccctccagacccttca catgtgatgaagccacaggattctggaggcagtgcccatgaacaggctgtgcagtga

DBGET integrated database retrieval system