Cricetulus griseus (Chinese hamster): 100759158 Help Entry 100759158         CDS       T02813                                  Symbol S100a10 Name (RefSeq) protein S100-A10 isoform X2   KO K17274   protein S100-A10 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04382   Cornified envelope formation cge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100759158 (S100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100759158 (S100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100759158 (S100a10) Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of microglial cells    100759158 (S100a10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  100759158 NCBI-ProteinID:  XP_027249197 UniProt:  G3HUU7 LinkDB All DBs Position 1 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagatggagcatgccatggaaaccatgatgcttacatttcacagatttgcg ggcgataaagactacttaacaaaggaggacctcagagtgctcatggaaagggagttccct gggtttttggaaaatcaaaaggatcccctggctgtggacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagctttttatcactggttgcagggctcatc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system