Cricetulus griseus (Chinese hamster): 100759332 Help Entry 100759332         CDS       T02813                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100759332  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100759332   09163 Immune disease    05322 Systemic lupus erythematosus     100759332   09165 Substance dependence    05034 Alcoholism     100759332  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100759332   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100759332 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100759332 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100759332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100759332 NCBI-ProteinID:  XP_027247581 UniProt:  A0A9J7F0Z0 LinkDB All DBs Position 1 Genome browser AA seq 136 aa AA seqDB search MASTKQTARKSTGGKAPRKQLATKAARKSASSTGGTKNPHHYRPGTVALCDIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLCFQSAAIGALQEASKAYMVGLFEDTNLCAIHAERVTI MPKDIQLACHIHGEGA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctagtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagctgctcgcaagagtgcatcctctactggagggacaaaaaatcctcat cattacaggcctggtactgtggcactctgtgatatcagacgctatcagaaatccactgaa cttctgattcgcaagctccccttccagcgtctggttcgagaaattgctcaggacttcaaa acagatctgtgcttccagagtgcagctattggtgctttgcaggaggcaagtaaagcctat atggttggcctttttgaagataccaacctgtgtgctatccacgccgaacgtgtaacaatt atgccaaaagatatccagctagcatgccacatacacggagaaggtgcttaa

DBGET integrated database retrieval system