Cricetulus griseus (Chinese hamster): 100760298 Help Entry 100760298         CDS       T02813                                  Symbol Ccl22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04061   Viral protein interaction with cytokine and cytokine receptor cge04062   Chemokine signaling pathway cge04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100760298 (Ccl22)    04061 Viral protein interaction with cytokine and cytokine receptor     100760298 (Ccl22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100760298 (Ccl22)    04062 Chemokine signaling pathway     100760298 (Ccl22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100760298 (Ccl22) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Chemokines    100760298 (Ccl22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100760298 NCBI-ProteinID:  XP_027261912 UniProt:  G3HIL1 LinkDB All DBs Position 3:170972903..170977306 Genome browser AA seq 93 aa AA seqDB search MSTLRIRLLVALILLAVALQTSDAGPYGANVEDSICCQDYIRYPLPSRVVKEFFWTSKSC RKPGVVLITIKNRDICADPRLPWVKRIIHKLAY NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtctaccctgcggatccggcttctggtggctctcattcttcttgctgtggcactccag acatcggatgcaggtccctatggtgccaacgtggaagacagcatctgctgccaggactac atccgctatcccctgccatcacgtgtagtgaaggagttcttctggacctcaaaatcctgc cgcaagcctggcgttgttttgataaccatcaagaaccgggatatctgtgctgaccccaga ctgccctgggtgaagaggattatccataagctggcctactga

DBGET integrated database retrieval system