Cricetulus griseus (Chinese hamster): 100760435 Help Entry 100760435         CDS       T02813                                  Symbol Cfl1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04360   Axon guidance cge04666   Fc gamma R-mediated phagocytosis cge04810   Regulation of actin cytoskeleton cge05133   Pertussis cge05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:cge00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100760435 (Cfl1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100760435 (Cfl1)   09158 Development and regeneration    04360 Axon guidance     100760435 (Cfl1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100760435 (Cfl1)   09171 Infectious disease: bacterial    05133 Pertussis     100760435 (Cfl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cge04131]     100760435 (Cfl1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cge04812]     100760435 (Cfl1)    04147 Exosome [BR:cge04147]     100760435 (Cfl1) Membrane trafficking [BR:cge04131]  Others   Actin-binding proteins    Others     100760435 (Cfl1) Cytoskeleton proteins [BR:cge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      100760435 (Cfl1) Exosome [BR:cge04147]  Exosomal proteins   Proteins found in most exosomes    100760435 (Cfl1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  100760435 NCBI-ProteinID:  XP_027264402 UniProt:  G3IDM2 LinkDB All DBs Position 3:complement(53847675..53851067) Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggtgtcatcaaagtgttcaatgatatgaaggtg cgcaagtcttcaacgccagaagaagtgaagaagcgcaagaaggcagtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggagacgtg gggcagactgtggacgacccctacaccacttttgtcaagatgctgcccgacaaggactgc cgctatgctctctacgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagagtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagctgacaggaatcaagcacgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagaaaaactaggtggcagcgccgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system