Cricetulus griseus (Chinese hamster): 100760602 Help Entry 100760602         CDS       T02813                                  Symbol Il12a Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04620   Toll-like receptor signaling pathway cge04622   RIG-I-like receptor signaling pathway cge04625   C-type lectin receptor signaling pathway cge04630   JAK-STAT signaling pathway cge04658   Th1 and Th2 cell differentiation cge04936   Alcoholic liver disease cge04940   Type I diabetes mellitus cge05133   Pertussis cge05134   Legionellosis cge05140   Leishmaniasis cge05142   Chagas disease cge05143   African trypanosomiasis cge05144   Malaria cge05145   Toxoplasmosis cge05146   Amoebiasis cge05152   Tuberculosis cge05162   Measles cge05164   Influenza A cge05168   Herpes simplex virus 1 infection cge05171   Coronavirus disease - COVID-19 cge05200   Pathways in cancer cge05321   Inflammatory bowel disease cge05330   Allograft rejection cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100760602 (Il12a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100760602 (Il12a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100760602 (Il12a)    04622 RIG-I-like receptor signaling pathway     100760602 (Il12a)    04625 C-type lectin receptor signaling pathway     100760602 (Il12a)    04658 Th1 and Th2 cell differentiation     100760602 (Il12a)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100760602 (Il12a)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100760602 (Il12a)    05164 Influenza A     100760602 (Il12a)    05162 Measles     100760602 (Il12a)    05168 Herpes simplex virus 1 infection     100760602 (Il12a)   09171 Infectious disease: bacterial    05133 Pertussis     100760602 (Il12a)    05134 Legionellosis     100760602 (Il12a)    05152 Tuberculosis     100760602 (Il12a)   09174 Infectious disease: parasitic    05146 Amoebiasis     100760602 (Il12a)    05144 Malaria     100760602 (Il12a)    05145 Toxoplasmosis     100760602 (Il12a)    05140 Leishmaniasis     100760602 (Il12a)    05142 Chagas disease     100760602 (Il12a)    05143 African trypanosomiasis     100760602 (Il12a)   09163 Immune disease    05321 Inflammatory bowel disease     100760602 (Il12a)    05330 Allograft rejection     100760602 (Il12a)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100760602 (Il12a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100760602 (Il12a)    04936 Alcoholic liver disease     100760602 (Il12a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100760602 (Il12a)    00536 Glycosaminoglycan binding proteins [BR:cge00536]     100760602 (Il12a) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interleukins    100760602 (Il12a) Glycosaminoglycan binding proteins [BR:cge00536]  Heparan sulfate / Heparin   Cytokines    100760602 (Il12a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 PilZN1 Motif Other DBs NCBI-GeneID:  100760602 NCBI-ProteinID:  XP_027247439 UniProt:  A0A9J7JA95 LinkDB All DBs Position 1 Genome browser AA seq 215 aa AA seqDB search MCPSRCLLFLTILVLLIHLSLARATPVSRPAQCLDRSQNLLRTTNHMLDKARQILKHYPC TAEDIDHEDITADKTSTLKACLPPELVKNESCLASTETASLTRGSCLPPRRTSLMMTLCL GSIYEDLKVYRTEFKAINAELLDHNQKQVILDENMLTAIDELMQALNLNGETLPQRPSQE EGDPYKVKMKLCILLQAFSIRAVTINRVMSYLNSS NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgtgtccatcgcgctgcctcctctttttgaccatccttgtcctcctaatccacctcagt ctggccagggccacaccagtctccagacctgcccagtgtcttgaccgctcccaaaacctg ctgaggaccaccaaccatatgctggataaggccagacaaattctgaaacattatccctgc actgctgaagacattgatcatgaagacatcacagcagacaaaaccagcacactgaaggcc tgtttaccaccggaactagtcaagaatgaaagttgtctggcttctacagagactgcttcc ctaacaagagggagctgcctgccccccagaaggacttctttgatgatgaccctgtgcctt ggtagcatctatgaggacttgaaggtgtaccggacagagttcaaggccatcaatgcagag cttttggatcataatcagaagcaggtgattctggatgagaacatgctgacggccattgat gagctgatgcaggctctgaatctcaatggtgagactctgccccagagaccttcccaggaa gaaggtgatccctacaaagtgaaaatgaagctctgcattctactacaggctttcagcatc cgtgctgtgactatcaacagagtgatgagctatctgaattcctcctga

DBGET integrated database retrieval system