Cricetulus griseus (Chinese hamster): 100760616 Help Entry 100760616         CDS       T02813                                  Name (RefSeq) interferon alpha-9 isoform X2   KO K05414   interferon alpha Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04151   PI3K-Akt signaling pathway cge04217   Necroptosis cge04620   Toll-like receptor signaling pathway cge04621   NOD-like receptor signaling pathway cge04622   RIG-I-like receptor signaling pathway cge04623   Cytosolic DNA-sensing pathway cge04630   JAK-STAT signaling pathway cge04650   Natural killer cell mediated cytotoxicity cge04936   Alcoholic liver disease cge05152   Tuberculosis cge05160   Hepatitis C cge05161   Hepatitis B cge05162   Measles cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05165   Human papillomavirus infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05170   Human immunodeficiency virus 1 infection cge05171   Coronavirus disease - COVID-19 cge05200   Pathways in cancer cge05320   Autoimmune thyroid disease cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100760616    04151 PI3K-Akt signaling pathway     100760616   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100760616  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100760616  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100760616    04621 NOD-like receptor signaling pathway     100760616    04622 RIG-I-like receptor signaling pathway     100760616    04623 Cytosolic DNA-sensing pathway     100760616    04650 Natural killer cell mediated cytotoxicity     100760616  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100760616   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100760616    05161 Hepatitis B     100760616    05160 Hepatitis C     100760616    05171 Coronavirus disease - COVID-19     100760616    05164 Influenza A     100760616    05162 Measles     100760616    05168 Herpes simplex virus 1 infection     100760616    05163 Human cytomegalovirus infection     100760616    05167 Kaposi sarcoma-associated herpesvirus infection     100760616    05169 Epstein-Barr virus infection     100760616    05165 Human papillomavirus infection     100760616   09171 Infectious disease: bacterial    05152 Tuberculosis     100760616   09163 Immune disease    05320 Autoimmune thyroid disease     100760616   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100760616   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100760616  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100760616 Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interferons    100760616 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100760616 NCBI-ProteinID:  XP_035294566 UniProt:  A0A9J7GRD5 LinkDB All DBs Position 2:complement(59282965..59283325) Genome browser AA seq 105 aa AA seqDB search MGRPFAFLMALVVMSYWSTCSLGCDLPQTHNIRNKRALTLLAQMRRLSPLSCLKDRKDFA FPLEKTVYLREKNHSPCAWEVVRAEVWRALSASANLLARLSEEKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggcaggccctttgctttcttgatggccctagtggtgatgagctactggtcaacctgc tctctgggatgtgacctgcctcagactcataacatcagaaacaagagagccttgacactc ctggcacaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttgca ttccctctggagaaaactgtctacctgagagagaagaaccacagcccctgtgcctgggag gtggtcagagcagaagtctggagagccctgtctgcctcagccaacttgctggcaagattg agtgaggagaaggaataa

DBGET integrated database retrieval system