Cricetulus griseus (Chinese hamster): 100761090 Help Entry 100761090         CDS       T02813                                  Symbol Dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04814   Motor proteins cge05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cge00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100761090 (Dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100761090 (Dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cge03037]     100761090 (Dynlt3)    04812 Cytoskeleton proteins [BR:cge04812]     100761090 (Dynlt3) Cilium and associated proteins [BR:cge03037]  Motile cilia and associated proteins   Dynein arm    100761090 (Dynlt3) Cytoskeleton proteins [BR:cge04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100761090 (Dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 GSP_synth Motif Other DBs NCBI-GeneID:  100761090 NCBI-ProteinID:  XP_027289083 UniProt:  G3HY85 LinkDB All DBs Position X:complement(115448450..115455876) Genome browser AA seq 116 aa AA seqDB search MEEYHRPCDEVGFNAEEAHNIVKECVDEVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAVAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccaccggccctgtgacgaggttggcttcaatgctgaagaagcacataat atagtcaaagagtgtgttgatgaagtcctaggaggtgaggactataatcagaacaacatt aaccagtggactgcaagcatagtggagcaatccctagcacatctggttaagctgggaaaa gcgtataagtacatcgtgacctgtgctgtggtccagaggagcgcttatggatttcataca gccagctcatgtttttgggatacaacatctgatggaacctgtactgtaagatgggagaac cgaaccatgaactgcatcgtcaatgtttttgcagttgctattgttctgtaa

DBGET integrated database retrieval system