Cricetulus griseus (Chinese hamster): 100761813 Help Entry 100761813         CDS       T02813                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100761813  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100761813   09163 Immune disease    05322 Systemic lupus erythematosus     100761813   09165 Substance dependence    05034 Alcoholism     100761813  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100761813   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100761813 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100761813 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100761813 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF DUF4840 Motif Other DBs NCBI-GeneID:  100761813 NCBI-ProteinID:  XP_027252713 UniProt:  G3IID7 LinkDB All DBs Position 2:410509222..410509880 Genome browser AA seq 136 aa AA seqDB search MVHTKQTARKSTGGKAPRKQLATKAALKSVPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFRHLVREIAQDFKTDLRFQSVAIGALQEASESCLVGLFEDTNLCAIHAKSVTV MPKAIQLAHRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggttcatacaaaacagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctctcaagagtgtgccctctactggaggggtgaaaaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaaatctactgaa cttctgattcgcaagctccccttccggcatctggttcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgtagctattggtgctttgcaggaggcaagtgagtcctgt ctggttggcctttttgaagataccaacctgtgtgccatccatgccaaaagtgtaacagtt atgccaaaagctatccaactagcacaccgaatacgtggagaacgtgcttaa

DBGET integrated database retrieval system