Cricetulus griseus (Chinese hamster): 100762373 Help Entry 100762373         CDS       T02813                                  Name (RefSeq) claudin-34-like   KO K06087   claudin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge03272   Virion - Hepatitis viruses cge04382   Cornified envelope formation cge04514   Cell adhesion molecule (CAM) interaction cge04530   Tight junction cge04670   Leukocyte transendothelial migration cge05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     100762373  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     100762373  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100762373  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100762373   09158 Development and regeneration    04382 Cornified envelope formation     100762373  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     100762373  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cge03037]     100762373    04147 Exosome [BR:cge04147]     100762373 Cilium and associated proteins [BR:cge03037]  Other cilia and associated proteins   Stereociliary proteins    100762373 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100762373   Exosomal proteins of colorectal cancer cells    100762373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Claudin_2 PMP22_Claudin DUF308 TMEM128 Motif Other DBs NCBI-GeneID:  100762373 NCBI-ProteinID:  XP_027288443 UniProt:  A0A9J7GMI1 LinkDB All DBs Position X:complement(90526206..90526924) Genome browser AA seq 184 aa AA seqDB search MNLPQWRVWCFEEPMESKPSLTLVGMWRTCVYHRENNSEFLRVCYQYTYQDTFIPLNIRV AQHLLLISSILGLIATISVIVALWKLYTGRLRKKITHNPFFVPGILNIIASVLVFISTLY NYLSIIRKDGIAFPPYFHIPNIPDNQKVGTALAMATLSSFLFLVGGTISISFTLPERSRP QSSI NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgaatctccctcaatggcgagtgtggtgtttcgaagaacccatggagtccaaacccagc ttgaccttagtaggaatgtggagaacctgtgtgtaccacagggaaaacaattctgaattt ttaagagtgtgttaccaatatacctaccaggacaccttcattcctttgaatatccgtgtt gctcaacacctactactgatctccagcattctcggcttgattgctacgatttctgtcatt gttgcactttggaaattgtacacaggaagactccggaagaaaatcactcacaatccattc ttcgtccccgggattctgaatatcattgctagcgtcttagtcttcatttccaccctgtat aattatttatccatcattcgcaaggatggaattgctttccccccatatttccacataccc aacatcccagataaccagaaagttggtactgccctggcaatggcaactctttcttcattc ttatttttagtgggtggcacaatctccatttctttcactcttcccgaacgttcccgacct cagtcttctatctaa

DBGET integrated database retrieval system