Cricetulus griseus (Chinese hamster): 100765062 Help Entry 100765062         CDS       T02813                                  Name (RefSeq) histone H3.1 isoform X2   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100765062  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100765062   09163 Immune disease    05322 Systemic lupus erythematosus     100765062   09165 Substance dependence    05034 Alcoholism     100765062  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100765062   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100765062 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100765062 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100765062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  100765062 NCBI-ProteinID:  XP_027288835 UniProt:  A0A3L7H289 LinkDB All DBs Position X:complement(67203328..67203738) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKVARKTAPATGGMKKQHRYHPGTVALREIRRYQKTTE LLIRKVPFQRLVREMAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERS NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcacgcaccaagcagacagcgcggaagtcgacgggaggcaaggccccacggaagcag ctggccacgaaggtggcacgcaagactgcaccggctactggtggcatgaagaagcagcac cgctaccacccaggcacggtggcgctgcgtgagatccgccgctaccagaagaccaccgag ttgctgatccgcaaggtgcccttccagcgcttggtacgtgagatggcccaggacttcaag actgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcctgcgagtcctac ctcgtggggctattcgaagacaccaacctgtgcgccatccacgccaagcgggtgaccatc atgccgaaagatatccagctggctcgtcgcattcgtggagagcgttcttag

DBGET integrated database retrieval system