Cricetulus griseus (Chinese hamster): 100766751 Help Entry 100766751         CDS       T02813                                  Symbol Calml3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04014   Ras signaling pathway cge04015   Rap1 signaling pathway cge04020   Calcium signaling pathway cge04022   cGMP-PKG signaling pathway cge04024   cAMP signaling pathway cge04070   Phosphatidylinositol signaling system cge04114   Oocyte meiosis cge04218   Cellular senescence cge04261   Adrenergic signaling in cardiomyocytes cge04270   Vascular smooth muscle contraction cge04371   Apelin signaling pathway cge04625   C-type lectin receptor signaling pathway cge04713   Circadian entrainment cge04720   Long-term potentiation cge04722   Neurotrophin signaling pathway cge04728   Dopaminergic synapse cge04740   Olfactory transduction cge04744   Phototransduction cge04750   Inflammatory mediator regulation of TRP channels cge04910   Insulin signaling pathway cge04912   GnRH signaling pathway cge04915   Estrogen signaling pathway cge04916   Melanogenesis cge04921   Oxytocin signaling pathway cge04922   Glucagon signaling pathway cge04924   Renin secretion cge04925   Aldosterone synthesis and secretion cge04970   Salivary secretion cge04971   Gastric acid secretion cge05010   Alzheimer disease cge05012   Parkinson disease cge05022   Pathways of neurodegeneration - multiple diseases cge05031   Amphetamine addiction cge05034   Alcoholism cge05133   Pertussis cge05152   Tuberculosis cge05163   Human cytomegalovirus infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05214   Glioma cge05417   Lipid and atherosclerosis cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100766751 (Calml3)    04015 Rap1 signaling pathway     100766751 (Calml3)    04371 Apelin signaling pathway     100766751 (Calml3)    04020 Calcium signaling pathway     100766751 (Calml3)    04070 Phosphatidylinositol signaling system     100766751 (Calml3)    04024 cAMP signaling pathway     100766751 (Calml3)    04022 cGMP-PKG signaling pathway     100766751 (Calml3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100766751 (Calml3)    04218 Cellular senescence     100766751 (Calml3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100766751 (Calml3)   09152 Endocrine system    04910 Insulin signaling pathway     100766751 (Calml3)    04922 Glucagon signaling pathway     100766751 (Calml3)    04912 GnRH signaling pathway     100766751 (Calml3)    04915 Estrogen signaling pathway     100766751 (Calml3)    04921 Oxytocin signaling pathway     100766751 (Calml3)    04916 Melanogenesis     100766751 (Calml3)    04924 Renin secretion     100766751 (Calml3)    04925 Aldosterone synthesis and secretion     100766751 (Calml3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100766751 (Calml3)    04270 Vascular smooth muscle contraction     100766751 (Calml3)   09154 Digestive system    04970 Salivary secretion     100766751 (Calml3)    04971 Gastric acid secretion     100766751 (Calml3)   09156 Nervous system    04728 Dopaminergic synapse     100766751 (Calml3)    04720 Long-term potentiation     100766751 (Calml3)    04722 Neurotrophin signaling pathway     100766751 (Calml3)   09157 Sensory system    04744 Phototransduction     100766751 (Calml3)    04740 Olfactory transduction     100766751 (Calml3)    04750 Inflammatory mediator regulation of TRP channels     100766751 (Calml3)   09159 Environmental adaptation    04713 Circadian entrainment     100766751 (Calml3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100766751 (Calml3)   09162 Cancer: specific types    05214 Glioma     100766751 (Calml3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100766751 (Calml3)    05163 Human cytomegalovirus infection     100766751 (Calml3)    05167 Kaposi sarcoma-associated herpesvirus infection     100766751 (Calml3)   09171 Infectious disease: bacterial    05133 Pertussis     100766751 (Calml3)    05152 Tuberculosis     100766751 (Calml3)   09164 Neurodegenerative disease    05010 Alzheimer disease     100766751 (Calml3)    05012 Parkinson disease     100766751 (Calml3)    05022 Pathways of neurodegeneration - multiple diseases     100766751 (Calml3)   09165 Substance dependence    05031 Amphetamine addiction     100766751 (Calml3)    05034 Alcoholism     100766751 (Calml3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100766751 (Calml3)    05418 Fluid shear stress and atherosclerosis     100766751 (Calml3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cge01009]     100766751 (Calml3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cge04131]     100766751 (Calml3)    03036 Chromosome and associated proteins [BR:cge03036]     100766751 (Calml3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100766751 (Calml3) Protein phosphatases and associated proteins [BR:cge01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100766751 (Calml3) Membrane trafficking [BR:cge04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100766751 (Calml3) Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100766751 (Calml3) Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100766751 (Calml3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF_SSP120 EFhand_Ca_insen BamM_C EF-hand_11 EF-hand_EFHB_C Dockerin_1 SAPC2_N DUF5580_M EF-hand_STIM1 FCaBP_EF-hand Caleosin DUF1103 SurA_N_3 RFC1 Motif Other DBs NCBI-GeneID:  100766751 NCBI-ProteinID:  XP_035297384 UniProt:  A0A061IBE8 LinkDB All DBs Position 3:complement(228857760..228858209) Genome browser AA seq 149 aa AA seqDB search MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG NGTVDFPEFLSMMSRKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE EVDEMIQAADTDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccaaccagctgactgaggagcaaatcgctgagttcaaggaggccttctctctgttt gacaaggatggggatggctgcatcaccacccaggaactgggcactgtcatgcggtccctg ggtcagaaccccacggaggctgagctccagggcatggtgaatgaaattgacaaagatgga aacggcactgtggacttccccgagttcctgagcatgatgtccaggaagatgaaagacacc gacagcgaggaggagatccgggaggccttccgagtgttcgacaaggatggcaacggctat gtcagcgctgctgagctgaggcatgtgatgaccaggcttggggagaagctgagtgacgag gaggtggacgaaatgatacaggcagcagatacagatggtgatgggcaagtgaactatgag gagtttgtccacatgctagtatccaagtga

DBGET integrated database retrieval system