Cricetulus griseus (Chinese hamster): 100769260 Help Entry 100769260         CDS       T02813                                  Symbol Il1a Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04010   MAPK signaling pathway cge04060   Cytokine-cytokine receptor interaction cge04217   Necroptosis cge04218   Cellular senescence cge04380   Osteoclast differentiation cge04640   Hematopoietic cell lineage cge04932   Non-alcoholic fatty liver disease cge04933   AGE-RAGE signaling pathway in diabetic complications cge04940   Type I diabetes mellitus cge05010   Alzheimer disease cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05133   Pertussis cge05140   Leishmaniasis cge05152   Tuberculosis cge05162   Measles cge05164   Influenza A cge05321   Inflammatory bowel disease cge05323   Rheumatoid arthritis cge05332   Graft-versus-host disease cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100769260 (Il1a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100769260 (Il1a)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100769260 (Il1a)    04218 Cellular senescence     100769260 (Il1a)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100769260 (Il1a)   09158 Development and regeneration    04380 Osteoclast differentiation     100769260 (Il1a)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100769260 (Il1a)    05162 Measles     100769260 (Il1a)   09171 Infectious disease: bacterial    05133 Pertussis     100769260 (Il1a)    05152 Tuberculosis     100769260 (Il1a)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100769260 (Il1a)   09163 Immune disease    05323 Rheumatoid arthritis     100769260 (Il1a)    05321 Inflammatory bowel disease     100769260 (Il1a)    05332 Graft-versus-host disease     100769260 (Il1a)   09164 Neurodegenerative disease    05010 Alzheimer disease     100769260 (Il1a)    05020 Prion disease     100769260 (Il1a)    05022 Pathways of neurodegeneration - multiple diseases     100769260 (Il1a)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100769260 (Il1a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100769260 (Il1a)    04932 Non-alcoholic fatty liver disease     100769260 (Il1a)    04933 AGE-RAGE signaling pathway in diabetic complications     100769260 (Il1a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100769260 (Il1a) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interleukins    100769260 (Il1a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep DUF5645 TMP-TENI MinC_N Motif Other DBs NCBI-GeneID:  100769260 NCBI-ProteinID:  XP_035302902 UniProt:  A0A8C2LJX2 LinkDB All DBs Position 6:49262651..49270464 Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYSSALDHLSLSQKSFYDASCGSLHENCTDKFVSLRTSETS KVSNFTFEESLVMVAASSDSGKILKKRRLGFNQAFAEDDLETITRNLEETIQSDSAPQFF QSNVRYKLIRRVKQDFVLNDSLNQNIYLDADKVHLKAASLTDLQHEVKFDMYAYSSGDSK YPVTLKISNTQLFVSAQGEDQPVLLKEIPETPKVITGSETDLIFFWKAVNSKNYFSSAAY PELFIATKEQSEVHLARGLPSMTDFQIA NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttccggacttgtttgaagacctgaagaactgttacagtgaaaatgaagaa tacagttctgcccttgatcatctctctctgagtcagaaatccttctacgatgcaagctgt ggctcacttcatgagaattgcacagataaatttgtatctctgagaacctctgaaacctca aaggtgtccaacttcacctttgaggagagcctagtgatggtggcagcatcatcagactca gggaagattctgaagaagagacggctgggcttcaatcaggcctttgctgaagatgacctg gagaccataacccgcaatttagaagagaccatccaatcagattcagcacctcaattcttc cagagcaatgtgagatacaaactgataaggcgtgtcaagcaggacttcgtcctgaatgat tccctcaatcaaaatatctacctggatgcagacaaggtgcatctcaaagcagcttcatta actgacctgcaacatgaagtaaaatttgacatgtatgcctactcatcgggagactctaaa tatcctgttactctaaaaatctcaaatactcagctgtttgtgagcgcgcaaggtgaagac cagcctgtgttgctgaaggagatacctgagacaccgaaagtcatcacagggagtgagacc gacctcattttcttctggaaagcagtcaactcaaagaactacttctcatcagctgcctac ccagagctctttattgccacaaaagaacaaagcgaggtgcacctggcaaggggactgccc tccatgacagacttccagatcgcataa

DBGET integrated database retrieval system