Cricetulus griseus (Chinese hamster): 100771736 Help Entry 100771736         CDS       T02813                                  Name (RefSeq) histone H3.3C   KO K11253   histone H3 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05202   Transcriptional misregulation in cancer cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100771736  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100771736   09163 Immune disease    05322 Systemic lupus erythematosus     100771736   09165 Substance dependence    05034 Alcoholism     100771736  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100771736   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100771736 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100771736 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100771736 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  100771736 NCBI-ProteinID:  XP_035295827 UniProt:  G3GSR4 LinkDB All DBs Position 2:complement(108859251..108859661) Genome browser AA seq 136 aa AA seqDB search MAPTKHTAHKSTGGKACRKQLATKATRKSESSSGGVKKPHRYRPGTVALREIRHYQKSTE LLIRKLPFQYLMREIAQDFKRDLHTQSTAVGALQEASEAYLVGRFEDSSLCAINAKCVTI MPKDIQLARRICREHA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcatactgcccacaaatccaccggtggtaaagcatgcaggaaacaa ctggctacaaaagccacgcgcaagagtgagtcctcttctggaggggtaaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacactatcagaaatccactgaa cttctgattcgcaagctccccttccagtatctgatgcgagaaattgctcaggacttcaaa agagatctgcacacccagagtacagctgttggtgctttgcaggaggcaagtgaggcctat ctggttggccgttttgaagattccagcctatgtgcaatcaatgctaagtgtgtaacaatt atgccaaaagatatccagctagcacgccgcatatgtagagaacatgcttaa

DBGET integrated database retrieval system