Cricetulus griseus (Chinese hamster): 100772438 Help Entry 100772438         CDS       T02813                                  Symbol Cck Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04080   Neuroactive ligand-receptor interaction cge04081   Hormone signaling cge04911   Insulin secretion cge04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100772438 (Cck)    04081 Hormone signaling     100772438 (Cck)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     100772438 (Cck)   09154 Digestive system    04972 Pancreatic secretion     100772438 (Cck)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100772438 (Cck) Cytokines and neuropeptides [BR:cge04052]  Neuropeptides   GPCR binding    100772438 (Cck) SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Motif Other DBs NCBI-GeneID:  100772438 NCBI-ProteinID:  XP_035299928 UniProt:  G3H992 LinkDB All DBs Position 4 Genome browser AA seq 115 aa AA seqDB search MKSSVCLCVLMAVLAAGALAQPVAPAEAAESAVQRAEEAPRRQLRAVLRTDGEPRARLGA LLARYIQQARKAPSGRMSVLKSLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaagagcagcgtgtgtctgtgcgtcctgatggcagtcctggctgcaggcgccctggcg cagccagtggcaccagcagaagccgcggagtcggcggtgcagcgggcagaggaggccccc cgaaggcagctgagggcggtgctcaggaccgacggcgagccccgagcgcgcctgggcgca ctgctcgcacgatacattcagcaggcacgcaaagctccttccggccgcatgtctgttctt aagtccctgcagagcctggaccctagccacaggatcagtgaccgagactacatgggctgg atggattttggccggcgcagtgctgaggactacgaatacccgtcctag

DBGET integrated database retrieval system