Cricetulus griseus (Chinese hamster): 100772696 Help Entry 100772696         CDS       T02813                                  Symbol Elob Name (RefSeq) elongin-B isoform X2   KO K03873   elongin-B Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04066   HIF-1 signaling pathway cge04120   Ubiquitin mediated proteolysis cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100772696 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100772696 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100772696 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     100772696 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100772696 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cge04121]     100772696 (Elob)    03400 DNA repair and recombination proteins [BR:cge03400]     100772696 (Elob) Ubiquitin system [BR:cge04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100772696 (Elob)    Cul5 complex      100772696 (Elob) DNA repair and recombination proteins [BR:cge03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100772696 (Elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  100772696 NCBI-ProteinID:  XP_027280690 UniProt:  A0A8C2MCD5 LinkDB All DBs Position 7:complement(43341502..43346537) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctaatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagtaccgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccgccggag gagcagcggctgtacaaggatgaccagctccttgatgacggaaaaactttgggcgagtgt ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga gcagatgatgcctttgaagctctgcgcattgagcccttctccagccctccagagcttcca gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system