Cricetulus griseus (Chinese hamster): 100773745 Help Entry 100773745         CDS       T02813                                  Symbol Ccl5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04061   Viral protein interaction with cytokine and cytokine receptor cge04062   Chemokine signaling pathway cge04620   Toll-like receptor signaling pathway cge04621   NOD-like receptor signaling pathway cge04623   Cytosolic DNA-sensing pathway cge04668   TNF signaling pathway cge05020   Prion disease cge05142   Chagas disease cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05168   Herpes simplex virus 1 infection cge05323   Rheumatoid arthritis cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100773745 (Ccl5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100773745 (Ccl5)    04061 Viral protein interaction with cytokine and cytokine receptor     100773745 (Ccl5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100773745 (Ccl5)    04621 NOD-like receptor signaling pathway     100773745 (Ccl5)    04623 Cytosolic DNA-sensing pathway     100773745 (Ccl5)    04062 Chemokine signaling pathway     100773745 (Ccl5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100773745 (Ccl5)    05168 Herpes simplex virus 1 infection     100773745 (Ccl5)    05163 Human cytomegalovirus infection     100773745 (Ccl5)   09174 Infectious disease: parasitic    05142 Chagas disease     100773745 (Ccl5)   09163 Immune disease    05323 Rheumatoid arthritis     100773745 (Ccl5)   09164 Neurodegenerative disease    05020 Prion disease     100773745 (Ccl5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100773745 (Ccl5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100773745 (Ccl5)    00536 Glycosaminoglycan binding proteins [BR:cge00536]     100773745 (Ccl5) Cytokines and neuropeptides [BR:cge04052]  Cytokines   Chemokines    100773745 (Ccl5) Glycosaminoglycan binding proteins [BR:cge00536]  Heparan sulfate / Heparin   Chemokines    100773745 (Ccl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100773745 NCBI-ProteinID:  XP_027282251 UniProt:  G3I8B1 LinkDB All DBs Position 7:complement(96771545..96776632) Genome browser AA seq 91 aa AA seqDB search METSAAVLAVILTVATLCAPTSASPHGSDTTPCCFAYLSLTLPRAHVKEYFYTSSKCSNF AVVFVTRRNRQVCANPKKKWVQEYINYLEMK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggagacctctgcagctgtcctcgctgtcatcctcactgttgccaccctctgcgctcct acatctgcctccccacatggctcggacaccactccctgctgctttgcctacctctccctt acactgcctcgtgcccacgtcaaggagtatttctacaccagcagcaagtgctccaacttt gcagtcgtctttgtgacccgaaggaaccgtcaagtgtgtgccaacccaaagaagaagtgg gttcaagaatacatcaactatttggagatgaagtag

DBGET integrated database retrieval system