Cricetulus griseus (Chinese hamster): 100773886 Help Entry 100773886         CDS       T02813                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05203   Viral carcinogenesis cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100773886  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100773886   09163 Immune disease    05322 Systemic lupus erythematosus     100773886   09165 Substance dependence    05034 Alcoholism     100773886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100773886   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cge04147]     100773886 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100773886 Exosome [BR:cge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100773886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100773886 NCBI-ProteinID:  XP_027265334 UniProt:  G3HDT7 LinkDB All DBs Position 3:complement(244834654..244835134) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcccgccaagtctgcgcccgccccgaagaagggctccaagaaggccgtgacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtactgaagcaggttcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcttctcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgt ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system